PRPS2 antibody (70R-3917)

Rabbit polyclonal PRPS2 antibody raised against the middle region of PRPS2

Synonyms Polyclonal PRPS2 antibody, Anti-PRPS2 antibody, PRPS2, PRPS-2, PRS II antibody, PRSII antibody, PRPS 2 antibody, Phosphoribosyl Pyrophosphate Synthetase 2 antibody, PRPS-2 antibody, PRPS 2
Specificity PRPS2 antibody was raised against the middle region of PRPS2
Cross Reactivity Human,Mouse,Rat,Dog,Drosophila,ZebraFish
Applications IHC, WB
Immunogen PRPS2 antibody was raised using the middle region of PRPS2 corresponding to a region with amino acids VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI
Assay Information PRPS2 Blocking Peptide, catalog no. 33R-9816, is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody

Images

Immunohistochemical staining using PRPS2 antibody (70R-3917)

PRPS2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRPS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The PRPS2 protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PRPS2 antibody (70R-3917) | PRPS2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using PRPS2 antibody (70R-3917) | PRPS2 antibody (70R-3917) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors