PRR13 antibody (70R-3720)

Rabbit polyclonal PRR13 antibody raised against the N terminal of PRR13

Synonyms Polyclonal PRR13 antibody, Anti-PRR13 antibody, PRR-13, TXR1 antibody, PRR-13 antibody, PRR 13 antibody, PRR13, FLJ23818 antibody, Proline Rich 13 antibody, DKFZp564J157 antibody, PRR 13
Specificity PRR13 antibody was raised against the N terminal of PRR13
Cross Reactivity Human
Applications WB
Immunogen PRR13 antibody was raised using the N terminal of PRR13 corresponding to a region with amino acids MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG
Assay Information PRR13 Blocking Peptide, catalog no. 33R-6618, is also available for use as a blocking control in assays to test for specificity of this PRR13 antibody


Western Blot analysis using PRR13 antibody (70R-3720)

PRR13 antibody (70R-3720) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRR13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRR13 antibody (70R-3720) | PRR13 antibody (70R-3720) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors