PRR16 antibody (70R-3413)

Rabbit polyclonal PRR16 antibody raised against the middle region of PRR16

Synonyms Polyclonal PRR16 antibody, Anti-PRR16 antibody, PRR 16, PRR-16, Proline Rich 16 antibody, PRR-16 antibody, MGC104614 antibody, PRR 16 antibody, PRR16, DSC54 antibody
Specificity PRR16 antibody was raised against the middle region of PRR16
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRR16 antibody was raised using the middle region of PRR16 corresponding to a region with amino acids RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL
Assay Information PRR16 Blocking Peptide, catalog no. 33R-7888, is also available for use as a blocking control in assays to test for specificity of this PRR16 antibody


Western Blot analysis using PRR16 antibody (70R-3413)

PRR16 antibody (70R-3413) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRR16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PRR16 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRR16 antibody (70R-3413) | PRR16 antibody (70R-3413) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors