PRR18 antibody (70R-4397)

Rabbit polyclonal PRR18 antibody raised against the N terminal of PRR18

Synonyms Polyclonal PRR18 antibody, Anti-PRR18 antibody, PRR-18 antibody, PRR-18, PRR18, PRR 18 antibody, MGC35308 antibody, PRR 18, Proline Rich Region 18 antibody
Specificity PRR18 antibody was raised against the N terminal of PRR18
Cross Reactivity Human
Applications WB
Immunogen PRR18 antibody was raised using the N terminal of PRR18 corresponding to a region with amino acids RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA
Assay Information PRR18 Blocking Peptide, catalog no. 33R-8101, is also available for use as a blocking control in assays to test for specificity of this PRR18 antibody


Western Blot analysis using PRR18 antibody (70R-4397)

PRR18 antibody (70R-4397) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRR18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PRR18 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRR18 antibody (70R-4397) | PRR18 antibody (70R-4397) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors