PRR5 antibody (70R-5245)

Rabbit polyclonal PRR5 antibody

Synonyms Polyclonal PRR5 antibody, Anti-PRR5 antibody, Proline Rich 5 antibody, PRR 5, PRR-5, PP610 antibody, FLJ20185 antibody, PRR 5 antibody, PRR-5 antibody, PRR5
Cross Reactivity Human
Applications WB
Immunogen PRR5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGS
Assay Information PRR5 Blocking Peptide, catalog no. 33R-3387, is also available for use as a blocking control in assays to test for specificity of this PRR5 antibody

Images

Western Blot analysis using PRR5 antibody (70R-5245)

PRR5 antibody (70R-5245) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRR5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRR5 antibody (70R-5245) | PRR5 antibody (70R-5245) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors