PRRG3 antibody (70R-6907)

Rabbit polyclonal PRRG3 antibody raised against the N terminal of PRRG3

Synonyms Polyclonal PRRG3 antibody, Anti-PRRG3 antibody, G-Carboxyglutamic Acid 3 antibody, MGC156177 antibody, PRRG 3 antibody, MGC149510 antibody, Proline Rich Gla antibody, PRRG 3, PRRG-3 antibody, TMG3 antibody, PRRG-3, PRRG3
Specificity PRRG3 antibody was raised against the N terminal of PRRG3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRRG3 antibody was raised using the N terminal of PRRG3 corresponding to a region with amino acids EEICSYEEVKEVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMYVVVPLL
Assay Information PRRG3 Blocking Peptide, catalog no. 33R-2360, is also available for use as a blocking control in assays to test for specificity of this PRRG3 antibody

Images

Western Blot analysis using PRRG3 antibody (70R-6907)

PRRG3 antibody (70R-6907) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRRG3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PRRG3 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRRG3 antibody (70R-6907) | PRRG3 antibody (70R-6907) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors