PRSS16 antibody (70R-6967)

Rabbit polyclonal PRSS16 antibody

Synonyms Polyclonal PRSS16 antibody, Anti-PRSS16 antibody, PRSS 16, PRSS-16 antibody, FLJ36271 antibody, FLJ40714 antibody, TSSP antibody, PRSS16, FLJ44172 antibody, Protease Serine 16 antibody, PRSS-16, PRSS 16 antibody
Cross Reactivity Human
Applications WB
Immunogen PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
Assay Information PRSS16 Blocking Peptide, catalog no. 33R-8518, is also available for use as a blocking control in assays to test for specificity of this PRSS16 antibody

Images

Western Blot analysis using PRSS16 antibody (70R-6967)

PRSS16 antibody (70R-6967) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRSS16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRSS16 antibody (70R-6967) | PRSS16 antibody (70R-6967) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors