PRSS3 antibody (70R-4536)

Rabbit polyclonal PRSS3 antibody raised against the N terminal of PRSS3

Synonyms Polyclonal PRSS3 antibody, Anti-PRSS3 antibody, PRSS-3 antibody, PRSS4 antibody, Protease Serine 3 antibody, PRSS 3, PRSS 3 antibody, MTG antibody, TRY3 antibody, PRSS3, TRY4 antibody, PRSS-3
Specificity PRSS3 antibody was raised against the N terminal of PRSS3
Cross Reactivity Human
Applications WB
Immunogen PRSS3 antibody was raised using the N terminal of PRSS3 corresponding to a region with amino acids VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
Assay Information PRSS3 Blocking Peptide, catalog no. 33R-9443, is also available for use as a blocking control in assays to test for specificity of this PRSS3 antibody

Images

Western Blot analysis using PRSS3 antibody (70R-4536)

PRSS3 antibody (70R-4536) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRSS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRSS3 antibody (70R-4536) | PRSS3 antibody (70R-4536) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors