PRSS35 antibody (70R-5474)

Rabbit polyclonal PRSS35 antibody raised against the N terminal of PRSS35

Synonyms Polyclonal PRSS35 antibody, Anti-PRSS35 antibody, PRSS-35, PRSS 35, PRSS35, MGC46520 antibody, PRSS-35 antibody, PRSS 35 antibody, C6orf158 antibody, Protease Serine 35 antibody, dJ223E3.1 antibody
Specificity PRSS35 antibody was raised against the N terminal of PRSS35
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRSS35 antibody was raised using the N terminal of PRSS35 corresponding to a region with amino acids PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG
Assay Information PRSS35 Blocking Peptide, catalog no. 33R-7394, is also available for use as a blocking control in assays to test for specificity of this PRSS35 antibody

Images

Western Blot analysis using PRSS35 antibody (70R-5474)

PRSS35 antibody (70R-5474) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRSS35 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PRSS35 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRSS35 antibody (70R-5474) | PRSS35 antibody (70R-5474) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors