PRSS8 antibody (70R-4537)

Rabbit polyclonal PRSS8 antibody raised against the middle region of PRSS8

Synonyms Polyclonal PRSS8 antibody, Anti-PRSS8 antibody, Protease Serine 8 antibody, PRSS-8, PROSTASIN antibody, CAP1 antibody, PRSS 8 antibody, PRSS-8 antibody, PRSS 8, PRSS8
Specificity PRSS8 antibody was raised against the middle region of PRSS8
Cross Reactivity Human
Applications WB
Immunogen PRSS8 antibody was raised using the middle region of PRSS8 corresponding to a region with amino acids PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE
Assay Information PRSS8 Blocking Peptide, catalog no. 33R-7163, is also available for use as a blocking control in assays to test for specificity of this PRSS8 antibody


Western Blot analysis using PRSS8 antibody (70R-4537)

PRSS8 antibody (70R-4537) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRSS8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRSS8 antibody (70R-4537) | PRSS8 antibody (70R-4537) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors