PSD3 antibody (70R-3151)

Rabbit polyclonal PSD3 antibody raised against the middle region of PSD3

Synonyms Polyclonal PSD3 antibody, Anti-PSD3 antibody, PSD3, EFA6R antibody, DKFZp761K1423 antibody, PSD 3 antibody, PSD 3, PSD-3, PSD-3 antibody, HCA67 antibody, Pleckstrin And Sec7 Domain Containing 3 antibody
Specificity PSD3 antibody was raised against the middle region of PSD3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSD3 antibody was raised using the middle region of PSD3 corresponding to a region with amino acids PDSYFSFEMPLTPMIQQRIKEGGQFLERTSGGGHQDILSVSADGGIVMGY
Assay Information PSD3 Blocking Peptide, catalog no. 33R-7026, is also available for use as a blocking control in assays to test for specificity of this PSD3 antibody


Western Blot analysis using PSD3 antibody (70R-3151)

PSD3 antibody (70R-3151) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 116 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSD3 is a guanine nucleotide exchange factor for ARF6.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSD3 antibody (70R-3151) | PSD3 antibody (70R-3151) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors