PSG1 antibody (70R-1586)

Rabbit polyclonal PSG1 antibody raised against the N terminal of PSG1

Synonyms Polyclonal PSG1 antibody, Anti-PSG1 antibody, PSGIIA antibody, PSG-1 antibody, PSG 1 antibody, PSG1, Pregnancy Specific Beta-1-Glycoprotein 1 antibody, FLJ90654 antibody, PBG1 antibody, FLJ90598 antibody, PSG 1, DHFRP2 antibody, SP1 antibody, PSGGA antibody, PSBG1 antibody, CD66f antibody, B1G1 antibody, PSG-1
Specificity PSG1 antibody was raised against the N terminal of PSG1
Cross Reactivity Human
Applications IHC, WB
Immunogen PSG1 antibody was raised using the N terminal of PSG1 corresponding to a region with amino acids SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE
Assay Information PSG1 Blocking Peptide, catalog no. 33R-8483, is also available for use as a blocking control in assays to test for specificity of this PSG1 antibody

Images

Immunohistochemical staining using PSG1 antibody (70R-1586)

PSG1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PSG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSG1 plays an immunomodulatory roles during pregnancy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PSG1 antibody (70R-1586) | PSG1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using PSG1 antibody (70R-1586) | PSG1 antibody (70R-1586) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors