PSG5 antibody (70R-5400)

Rabbit polyclonal PSG5 antibody raised against the middle region of PSG5

Synonyms Polyclonal PSG5 antibody, Anti-PSG5 antibody, PSG-5 antibody, PSG-5, PSG antibody, FL-NCA-3 antibody, PSG 5, PSG 5 antibody, Pregnancy Specific Beta-1-Glycoprotein 5 antibody, PSG5
Specificity PSG5 antibody was raised against the middle region of PSG5
Cross Reactivity Human
Applications WB
Immunogen PSG5 antibody was raised using the middle region of PSG5 corresponding to a region with amino acids SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI
Assay Information PSG5 Blocking Peptide, catalog no. 33R-8536, is also available for use as a blocking control in assays to test for specificity of this PSG5 antibody


Western Blot analysis using PSG5 antibody (70R-5400)

PSG5 antibody (70R-5400) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSG5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSG5 antibody (70R-5400) | PSG5 antibody (70R-5400) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors