PSG6 antibody (70R-3426)

Rabbit polyclonal PSG6 antibody raised against the N terminal of PSG6

Synonyms Polyclonal PSG6 antibody, Anti-PSG6 antibody, PSG 6, PSG10 antibody, PSG6, PSG-6 antibody, PSG-6, PSG 6 antibody, Pregnancy Specific Beta-1-Glycoprotein 6 antibody
Specificity PSG6 antibody was raised against the N terminal of PSG6
Cross Reactivity Human
Applications WB
Immunogen PSG6 antibody was raised using the N terminal of PSG6 corresponding to a region with amino acids VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV
Assay Information PSG6 Blocking Peptide, catalog no. 33R-9675, is also available for use as a blocking control in assays to test for specificity of this PSG6 antibody


Western Blot analysis using PSG6 antibody (70R-3426)

PSG6 antibody (70R-3426) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSG6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSG6 may have a role in modulation of the innate immune system.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSG6 antibody (70R-3426) | PSG6 antibody (70R-3426) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors