PSMA1 antibody (70R-1371)

Rabbit polyclonal PSMA1 antibody

Synonyms Polyclonal PSMA1 antibody, Anti-PSMA1 antibody, Proteasome macropain subunit alpha type 1 antibody, MGC21459 antibody, PROS30 antibody, MGC1667 antibody, MGC14751 antibody, PSMA 1 antibody, MGC23915 antibody, HC2 antibody, MGC14542 antibody, NU antibody, PSMA1, PSMA-1, MGC22853 antibody, PSMA-1 antibody, MGC14575 antibody, Prosome Macropain Subunit Alpha Type 1 antibody, PSMA 1
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen PSMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK
Assay Information PSMA1 Blocking Peptide, catalog no. 33R-6001, is also available for use as a blocking control in assays to test for specificity of this PSMA1 antibody

Western Blot analysis using PSMA1 antibody (70R-1371)

PSMA1 antibody (70R-1371) used at 1.25 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PSMA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using PSMA1 antibody (70R-1371) | PSMA1 antibody (70R-1371) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors