PSMA6 antibody (70R-4759)

Rabbit polyclonal PSMA6 antibody

Synonyms Polyclonal PSMA6 antibody, Anti-PSMA6 antibody, Prosome Macropain Subunit Alpha Type 6 antibody, PSMA6, PSMA 6 antibody, PROS27 antibody, IOTA antibody, p27K antibody, Proteasome macropain subunit alpha type 6 antibody, PSMA-6, MGC22756 antibody, MGC2333 antibody, PSMA-6 antibody, PSMA 6, MGC23846 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSMA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITEN
Assay Information PSMA6 Blocking Peptide, catalog no. 33R-2815, is also available for use as a blocking control in assays to test for specificity of this PSMA6 antibody

Images

Western Blot analysis using PSMA6 antibody (70R-4759)

PSMA6 antibody (70R-4759) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMA6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA6 is a member of the peptidase T1A family, which is a 20S core alpha subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PSMA6 antibody (70R-4759) | PSMA6 antibody (70R-4759) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors