PSMC4 antibody (70R-4334)

Rabbit polyclonal PSMC4 antibody

Synonyms Polyclonal PSMC4 antibody, Anti-PSMC4 antibody, PSMC 4, PSMC4, TBP7 antibody, MGC8570 antibody, MGC13687 antibody, PSMC-4 antibody, PSMC-4, MGC23214 antibody, PSMC 4 antibody, S6 antibody, Proteasome macropain 26S subunit ATPase 4 antibody, MIP224 antibody, Prosome Macropain 26S Subunit Atpase 4 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSMC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
Assay Information PSMC4 Blocking Peptide, catalog no. 33R-5903, is also available for use as a blocking control in assays to test for specificity of this PSMC4 antibody


Western Blot analysis using PSMC4 antibody (70R-4334)

PSMC4 antibody (70R-4334) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSMC4 antibody (70R-4334) | PSMC4 antibody (70R-4334) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors