PSMD1 antibody (70R-5638)

Rabbit polyclonal PSMD1 antibody

Synonyms Polyclonal PSMD1 antibody, Anti-PSMD1 antibody, P112 antibody, PSMD-1, PSMD 1, PSMD1, PSMD 1 antibody, Proteasome macropain 26S subunit non-ATPase 1 antibody, PSMD-1 antibody, MGC133040 antibody, MGC133041 antibody, S1 antibody, Prosome Macropain 26S Subunit Non-Atpase 1 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen PSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE
Assay Information PSMD1 Blocking Peptide, catalog no. 33R-2074, is also available for use as a blocking control in assays to test for specificity of this PSMD1 antibody


Western Blot analysis using PSMD1 antibody (70R-5638)

PSMD1 antibody (70R-5638) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 106 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSMD1 antibody (70R-5638) | PSMD1 antibody (70R-5638) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors