PSMD10 antibody (70R-4328)

Rabbit polyclonal PSMD10 antibody

Synonyms Polyclonal PSMD10 antibody, Anti-PSMD10 antibody, Proteasome macropain 26S subunit non-ATPase 10 antibody, Prosome Macropain 26S Subunit Non-Atpase 10 antibody, PSMD10, PSMD-10 antibody, PSMD-10, PSMD 10, PSMD 10 antibody, dJ889N15.2 antibody, p28 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSMD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLV
Assay Information PSMD10 Blocking Peptide, catalog no. 33R-6101, is also available for use as a blocking control in assays to test for specificity of this PSMD10 antibody


Western Blot analysis using PSMD10 antibody (70R-4328)

PSMD10 antibody (70R-4328) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMD10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSMD10 antibody (70R-4328) | PSMD10 antibody (70R-4328) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors