PSMG1 antibody (70R-1967)

Rabbit polyclonal PSMG1 antibody

Synonyms Polyclonal PSMG1 antibody, Anti-PSMG1 antibody, PSMG-1, C21LRP antibody, LRPC21 antibody, PSMG1, PAC1 antibody, PSMG 1 antibody, Proteasome macropain assembly chaperone 1 antibody, DSCR2 antibody, PSMG-1 antibody, Prosome Macropain Assembly Chaperone 1 antibody, PSMG 1
Cross Reactivity Human
Applications WB
Immunogen PSMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
Assay Information PSMG1 Blocking Peptide, catalog no. 33R-9697, is also available for use as a blocking control in assays to test for specificity of this PSMG1 antibody

Images

Western Blot analysis using PSMG1 antibody (70R-1967)

PSMG1 antibody (70R-1967) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PSMG1 antibody (70R-1967) | PSMG1 antibody (70R-1967) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors