PSMG3 Blocking Peptide (33R-10426)

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMG3 antibody, catalog no. 70R-10090

Synonyms PSMG3 control peptide, PSMG3 antibody Blocking Peptide, Anti-PSMG3 Blocking Peptide, proteasome, prosome, macropain assembly chaperone 3 Blocking Peptide, C7orf48 Blocking Peptide, MGC10911 Blocking Peptide, PAC3 Blocking Peptide, PSMG3, PSMG-3, PSMG 3, PSMG-3 Blocking Peptide, PSMG 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREV
Molecular Weight 13 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSMG3 is a chaperone protein which promotes assembly of the 20S proteasome. It may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors