PTCH2 antibody (70R-6356)

Rabbit polyclonal PTCH2 antibody

Synonyms Polyclonal PTCH2 antibody, Anti-PTCH2 antibody, PTCH-2, PTCH 2 antibody, PTCH-2 antibody, PTCH2, PTCH 2, Patched Homolog 2 antibody
Cross Reactivity Human
Applications WB
Immunogen PTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV
Assay Information PTCH2 Blocking Peptide, catalog no. 33R-4790, is also available for use as a blocking control in assays to test for specificity of this PTCH2 antibody

Images

Western Blot analysis using PTCH2 antibody (70R-6356)

PTCH2 antibody (70R-6356) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 130 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTCH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTCH2 is a member of the patched protein family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. The gene encoding PTCH2 is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTCH2 antibody (70R-6356) | PTCH2 antibody (70R-6356) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors