PTDSS1 antibody (70R-6873)

Rabbit polyclonal PTDSS1 antibody raised against the N terminal of PTDSS1

Synonyms Polyclonal PTDSS1 antibody, Anti-PTDSS1 antibody, PSSA antibody, PTDSS-1 antibody, PTDSS1, PTDSS 1, KIAA0024 antibody, PTDSS 1 antibody, Phosphatidylserine Synthase 1 antibody, PTDSS-1
Specificity PTDSS1 antibody was raised against the N terminal of PTDSS1
Cross Reactivity Human
Applications WB
Immunogen PTDSS1 antibody was raised using the N terminal of PTDSS1 corresponding to a region with amino acids MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI
Assay Information PTDSS1 Blocking Peptide, catalog no. 33R-5738, is also available for use as a blocking control in assays to test for specificity of this PTDSS1 antibody

Images

Western Blot analysis using PTDSS1 antibody (70R-6873)

PTDSS1 antibody (70R-6873) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTDSS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTDSS1 is a multi-pass membrane protein. It belongs to the phosphatidyl serine synthase family. PTDSS1 catalyzes a base-exchange reaction in which the polar head group of phosphatidylcholine is replaced by L-serine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTDSS1 antibody (70R-6873) | PTDSS1 antibody (70R-6873) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors