PTGER3 antibody (70R-6527)

Rabbit polyclonal PTGER3 antibody

Synonyms Polyclonal PTGER3 antibody, Anti-PTGER3 antibody, PTGER-3, PTGER 3 antibody, EP3-II antibody, MGC141829 antibody, PTGER3, EP3e antibody, Prostaglandin E Receptor 3 antibody, EP3-IV antibody, PTGER-3 antibody, EP3 antibody, MGC141828 antibody, MGC27302 antibody, EP3-I antibody, PTGER 3, EP3-III antibody
Cross Reactivity Human
Applications WB
Immunogen PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL
Assay Information PTGER3 Blocking Peptide, catalog no. 33R-8894, is also available for use as a blocking control in assays to test for specificity of this PTGER3 antibody


Western Blot analysis using PTGER3 antibody (70R-6527)

PTGER3 antibody (70R-6527) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTGER3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTGER3 is the receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PTGER3 antibody (70R-6527) | PTGER3 antibody (70R-6527) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors