PTGIS antibody (70R-7255)

Rabbit polyclonal PTGIS antibody

Synonyms Polyclonal PTGIS antibody, Anti-PTGIS antibody, Prostacyclin Synthase antibody, CYP8A1 antibody, MGC126858 antibody, PGIS antibody, MGC126860 antibody, CYP8 antibody, PTGI antibody, Prostaglandin I2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PTGIS antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS
Assay Information PTGIS Blocking Peptide, catalog no. 33R-2493, is also available for use as a blocking control in assays to test for specificity of this PTGIS antibody


Western Blot analysis using PTGIS antibody (70R-7255)

PTGIS antibody (70R-7255) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTGIS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PTGIS antibody (70R-7255) | PTGIS antibody (70R-7255) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors