PTGS1 antibody (70R-7317)

Rabbit polyclonal PTGS1 antibody raised against the middle region of PTGS1

Synonyms Polyclonal PTGS1 antibody, Anti-PTGS1 antibody, PTGS-1, PCOX1 antibody, Prostaglandin-Endoperoxide Synthase 1 antibody, PHS1 antibody, PTGHS antibody, COX1 antibody, PGHS-1 antibody, COX3 antibody, PGG/HS antibody, PTGS 1, PGHS1 antibody, PTGS1, PTGS 1 antibody, PTGS-1 antibody
Specificity PTGS1 antibody was raised against the middle region of PTGS1
Cross Reactivity Human,Mouse
Applications WB
Immunogen PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE
Assay Information PTGS1 Blocking Peptide, catalog no. 33R-3265, is also available for use as a blocking control in assays to test for specificity of this PTGS1 antibody

Images

Western Blot analysis using PTGS1 antibody (70R-7317)

PTGS1 antibody (70R-7317) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTGS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTGS1 antibody (70R-7317) | PTGS1 antibody (70R-7317) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors