PTPLAD1 antibody (70R-5958)

Rabbit polyclonal PTPLAD1 antibody raised against the N terminal of PTPLAD1

Synonyms Polyclonal PTPLAD1 antibody, Anti-PTPLAD1 antibody, B-IND1 antibody, PTPLAD-1 antibody, PTPLAD 1, FLJ90376 antibody, Protein Tyrosine Phosphatase-Like A Domain Containing 1 antibody, HSPC121 antibody, PTPLAD1, PTPLAD 1 antibody, PTPLAD-1
Specificity PTPLAD1 antibody was raised against the N terminal of PTPLAD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PTPLAD1 antibody was raised using the N terminal of PTPLAD1 corresponding to a region with amino acids WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFL
Assay Information PTPLAD1 Blocking Peptide, catalog no. 33R-9968, is also available for use as a blocking control in assays to test for specificity of this PTPLAD1 antibody

Images

Western Blot analysis using PTPLAD1 antibody (70R-5958)

PTPLAD1 antibody (70R-5958) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTPLAD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTPLAD1 is a multi-pass membrane protein. It belongs to the PTPLA family and contains 1 CS domain. PTPLAD1 (hB-ind1) plays a crucial role in HCV RNA replication and the propagation of JFH1 virus through interaction with viral and host proteins. It is involved in Rac1-signaling pathways leading to the modulation of gene expression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTPLAD1 antibody (70R-5958) | PTPLAD1 antibody (70R-5958) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors