PTPLAD2 antibody (70R-6315)

Rabbit polyclonal PTPLAD2 antibody raised against the middle region of PTPLAD2

Synonyms Polyclonal PTPLAD2 antibody, Anti-PTPLAD2 antibody, PTPLAD-2, PTPLAD 2 antibody, Protein Tyrosine Phosphatase-Like A Domain Containing 2 antibody, PTPLAD-2 antibody, PTPLAD2, DKFZp686G24132 antibody, PTPLAD 2, DKFZp686F01145 antibody
Specificity PTPLAD2 antibody was raised against the middle region of PTPLAD2
Cross Reactivity Human
Applications WB
Immunogen PTPLAD2 antibody was raised using the middle region of PTPLAD2 corresponding to a region with amino acids LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW
Assay Information PTPLAD2 Blocking Peptide, catalog no. 33R-5146, is also available for use as a blocking control in assays to test for specificity of this PTPLAD2 antibody

Images

Western Blot analysis using PTPLAD2 antibody (70R-6315)

PTPLAD2 antibody (70R-6315) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTPLAD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTPLAD2 is a multi-pass membrane protein. It belongs to the PTPLA family. The function of the PTPLAD2 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTPLAD2 antibody (70R-6315) | PTPLAD2 antibody (70R-6315) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors