PTPN5 antibody (70R-6729)

Rabbit polyclonal PTPN5 antibody

Synonyms Polyclonal PTPN5 antibody, Anti-PTPN5 antibody, PTPN 5, PTPSTEP antibody, PTPN5, Protein Tyrosine Phosphatase Non-Receptor Type 5 antibody, FLJ14427 antibody, PTPN 5 antibody, Striatum-Enriched antibody, STEP antibody, PTPN-5, PTPN-5 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PTPN5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNE
Assay Information PTPN5 Blocking Peptide, catalog no. 33R-9722, is also available for use as a blocking control in assays to test for specificity of this PTPN5 antibody

Images

Western Blot analysis using PTPN5 antibody (70R-6729)

PTPN5 antibody (70R-6729) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTPN5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PTPN5 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTPN5 antibody (70R-6729) | PTPN5 antibody (70R-6729) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors