PTPRA antibody (70R-7310)

Rabbit polyclonal PTPRA antibody raised against the C terminal of PTPRA

Synonyms Polyclonal PTPRA antibody, Anti-PTPRA antibody, LRP antibody, HPTPalpha antibody, RPTPA antibody, R-PTP-alpha antibody, HEPTP antibody, HLPR antibody, HPTPA antibody, PTPRL2 antibody, PTPA antibody, Protein Tyrosine Phosphatase Receptor Type A antibody
Specificity PTPRA antibody was raised against the C terminal of PTPRA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PTPRA antibody was raised using the C terminal of PTPRA corresponding to a region with amino acids SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG
Assay Information PTPRA Blocking Peptide, catalog no. 33R-8769, is also available for use as a blocking control in assays to test for specificity of this PTPRA antibody

Images

Western Blot analysis using PTPRA antibody (70R-7310)

PTPRA antibody (70R-7310) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTPRA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTPRA is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPRA contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. PTPRA has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTPRA antibody (70R-7310) | PTPRA antibody (70R-7310) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors