PTPRE antibody (70R-7313)

Rabbit polyclonal PTPRE antibody raised against the middle region of PTPRE

Synonyms Polyclonal PTPRE antibody, Anti-PTPRE antibody, PTPE antibody, Protein Tyrosine Phosphatase Receptor Type E antibody, HPTPE antibody, DKFZp313F1310 antibody, R-PTP-EPSILON antibody
Specificity PTPRE antibody was raised against the middle region of PTPRE
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PTPRE antibody was raised using the middle region of PTPRE corresponding to a region with amino acids VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEW
Assay Information PTPRE Blocking Peptide, catalog no. 33R-9603, is also available for use as a blocking control in assays to test for specificity of this PTPRE antibody

Images

Western Blot analysis using PTPRE antibody (70R-7313)

PTPRE antibody (70R-7313) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTPRE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTPRE is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Two alternatively spliced transcript variants of this gene have been reported, one of which encodes a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTPRE antibody (70R-7313) | PTPRE antibody (70R-7313) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors