PTPRH antibody (70R-7142)

Rabbit polyclonal PTPRH antibody raised against the middle region of PTPRH

Synonyms Polyclonal PTPRH antibody, Anti-PTPRH antibody, MGC133059 antibody, MGC133058 antibody, Protein Tyrosine Phosphatase Receptor Type H antibody, SAP-1 antibody, FLJ39938 antibody
Specificity PTPRH antibody was raised against the middle region of PTPRH
Cross Reactivity Human
Applications WB
Immunogen PTPRH antibody was raised using the middle region of PTPRH corresponding to a region with amino acids QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT
Assay Information PTPRH Blocking Peptide, catalog no. 33R-7755, is also available for use as a blocking control in assays to test for specificity of this PTPRH antibody

Images

Western Blot analysis using PTPRH antibody (70R-7142)

PTPRH antibody (70R-7142) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 120 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTPRH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTPRH is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. The extracellular region contains eight fibronectin type III-like repeats and multiple N-glycosylation sites. It was also found to be expressed in several cancer cell lines, but not in the corresponding normal tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTPRH antibody (70R-7142) | PTPRH antibody (70R-7142) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors