PTPRR antibody (70R-7149)

Rabbit polyclonal PTPRR antibody raised against the C terminal of PTPRR

Synonyms Polyclonal PTPRR antibody, Anti-PTPRR antibody, Protein Tyrosine Phosphatase Receptor Type R antibody, MGC131968 antibody, MGC148170 antibody, EC-PTP antibody, PTP-SL antibody, FLJ34328 antibody, PTPBR7 antibody, PTPRQ antibody, PCPTP1 antibody, DKFZp781C1038 antibody
Specificity PTPRR antibody was raised against the C terminal of PTPRR
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PTPRR antibody was raised using the C terminal of PTPRR corresponding to a region with amino acids NYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRL
Assay Information PTPRR Blocking Peptide, catalog no. 33R-6944, is also available for use as a blocking control in assays to test for specificity of this PTPRR antibody

Images

Western Blot analysis using PTPRR antibody (70R-7149)

PTPRR antibody (70R-7149) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTPRR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTPRR antibody (70R-7149) | PTPRR antibody (70R-7149) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors