PTRH2 antibody (70R-1785)

Rabbit polyclonal PTRH2 antibody raised against the C terminal of PTRH2

Synonyms Polyclonal PTRH2 antibody, Anti-PTRH2 antibody, BIT1 antibody, CGI-147 antibody, PTRH 2, Peptidyl-tRNA Hydrolase 2 antibody, PTH2 antibody, PTRH-2, PTRH-2 antibody, FLJ32471 antibody, PTRH2, PTRH 2 antibody
Specificity PTRH2 antibody was raised against the C terminal of PTRH2
Cross Reactivity Human
Applications WB
Immunogen PTRH2 antibody was raised using the C terminal of PTRH2 corresponding to a region with amino acids RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT
Assay Information PTRH2 Blocking Peptide, catalog no. 33R-8080, is also available for use as a blocking control in assays to test for specificity of this PTRH2 antibody

Images

Western Blot analysis using PTRH2 antibody (70R-1785)

PTRH2 antibody (70R-1785) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PTRH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTRH2 antibody (70R-1785) | PTRH2 antibody (70R-1785) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors