PUM2 antibody (70R-4872)

Rabbit polyclonal PUM2 antibody

Synonyms Polyclonal PUM2 antibody, Anti-PUM2 antibody, FLJ36528 antibody, KIAA0235 antibody, MGC138253 antibody, MGC138251 antibody, PUM-2, PUM 2 antibody, PUM2, PUM 2, PUMH2 antibody, PUM-2 antibody, Pumilio Homolog 2 antibody, PUML2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PUM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAW
Assay Information PUM2 Blocking Peptide, catalog no. 33R-6245, is also available for use as a blocking control in assays to test for specificity of this PUM2 antibody

Images

Western Blot analysis using PUM2 antibody (70R-4872)

PUM2 antibody (70R-4872) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 114 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PUM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PUM2 is a sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of mRNA targets. Its interactions and tissue specificity suggest that it may be required to support proliferation and self-renewal of stem cells by regulating the translation of key transcripts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PUM2 antibody (70R-4872) | PUM2 antibody (70R-4872) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors