PVRL3 antibody (70R-6424)

Rabbit polyclonal PVRL3 antibody raised against the middle region of PVRL3

Synonyms Polyclonal PVRL3 antibody, Anti-PVRL3 antibody, PVRR3 antibody, nectin-3 antibody, PVRL 3 antibody, PRR3 antibody, PVRL-3 antibody, DKFZP566B0846 antibody, PVRL3, PVRL-3, CDw113 antibody, Poliovirus Receptor-Related 3 antibody, PPR3 antibody, FLJ90624 antibody, PVRL 3
Specificity PVRL3 antibody was raised against the middle region of PVRL3
Cross Reactivity Human
Applications WB
Immunogen PVRL3 antibody was raised using the middle region of PVRL3 corresponding to a region with amino acids PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM
Assay Information PVRL3 Blocking Peptide, catalog no. 33R-7025, is also available for use as a blocking control in assays to test for specificity of this PVRL3 antibody

Images

Western Blot analysis using PVRL3 antibody (70R-6424)

PVRL3 antibody (70R-6424) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PVRL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nectins are immunoglobulin-like adhesion molecules that interact with afadin. Afadin is an actin filament-binding protein that connects nectins to the actin cytoskeleton. The nectin-afadin system organizes adherens junctions cooperatively with the cadherin-catenin system in epithelial cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PVRL3 antibody (70R-6424) | PVRL3 antibody (70R-6424) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors