PXT1 antibody (70R-4253)

Rabbit polyclonal PXT1 antibody raised against the middle region of PXT1

Synonyms Polyclonal PXT1 antibody, Anti-PXT1 antibody, MGC129569 antibody, PXT-1 antibody, PXT1, Peroxisomal Testis Specific 1 antibody, PXT 1 antibody, PXT 1, STEPP antibody, PXT-1
Specificity PXT1 antibody was raised against the middle region of PXT1
Cross Reactivity Human
Applications WB
Immunogen PXT1 antibody was raised using the middle region of PXT1 corresponding to a region with amino acids MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL
Assay Information PXT1 Blocking Peptide, catalog no. 33R-6334, is also available for use as a blocking control in assays to test for specificity of this PXT1 antibody


Western blot analysis using PXT1 antibody (70R-4253)

Recommended PXT1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 6 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PXT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PXT1 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using PXT1 antibody (70R-4253) | Recommended PXT1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors