PYCR1 antibody (70R-5378)

Rabbit polyclonal PYCR1 antibody raised against the middle region of PYCR1

Synonyms Polyclonal PYCR1 antibody, Anti-PYCR1 antibody, PYCR-1, PIG45 antibody, Pyrroline-5-Carboxylate Reductase 1 antibody, PYCR1, PYCR antibody, PYCR-1 antibody, PP222 antibody, PYCR 1, P5C antibody, PYCR 1 antibody, P5CR antibody
Specificity PYCR1 antibody was raised against the middle region of PYCR1
Cross Reactivity Human
Applications WB
Immunogen PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE
Assay Information PYCR1 Blocking Peptide, catalog no. 33R-8196, is also available for use as a blocking control in assays to test for specificity of this PYCR1 antibody

Images

Western Blot analysis using PYCR1 antibody (70R-5378)

PYCR1 antibody (70R-5378) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PYCR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PYCR1 antibody (70R-5378) | PYCR1 antibody (70R-5378) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors