PYGB Blocking Peptide (33R-1085)

A synthetic peptide for use as a blocking control in assays to test for specificity of PYGB antibody, catalog no. 70R-2604

Synonyms PYGB control peptide, PYGB antibody Blocking Peptide, Anti-PYGB Blocking Peptide, Phosphorylase Glycogen; Brain Blocking Peptide, MGC9213 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT
Molecular Weight 97 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors