PYY antibody (70R-6244)

Rabbit polyclonal PYY antibody raised against the middle region of PYY

Synonyms Polyclonal PYY antibody, Anti-PYY antibody, PYY1 antibody, Peptide Yy antibody
Specificity PYY antibody was raised against the middle region of PYY
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED
Assay Information PYY Blocking Peptide, catalog no. 33R-1436, is also available for use as a blocking control in assays to test for specificity of this PYY antibody

Images

Western Blot analysis using PYY antibody (70R-6244)

PYY antibody (70R-6244) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 11 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PYY antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PYY antibody (70R-6244) | PYY antibody (70R-6244) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors