QPCT antibody (70R-5342)

Rabbit polyclonal QPCT antibody

Synonyms Polyclonal QPCT antibody, Anti-QPCT antibody, GCT antibody, QC antibody, Glutaminyl-Peptide Cyclotransferase antibody, Glutaminyl Cyclase antibody
Cross Reactivity Human
Applications WB
Immunogen QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA
Assay Information QPCT Blocking Peptide, catalog no. 33R-8755, is also available for use as a blocking control in assays to test for specificity of this QPCT antibody

Images

Western Blot analysis using QPCT antibody (70R-5342)

QPCT antibody (70R-5342) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of QPCT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance QPCT is responsible for the biosynthesis of pyroglutamyl peptides. QPCT has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. It also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using QPCT antibody (70R-5342) | QPCT antibody (70R-5342) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors