QPCTL antibody (70R-7419)

Rabbit polyclonal QPCTL antibody raised against the middle region of QPCTL

Synonyms Polyclonal QPCTL antibody, Anti-QPCTL antibody, Glutaminyl-Peptide Cyclotransferase-Like antibody, FLJ20084 antibody
Specificity QPCTL antibody was raised against the middle region of QPCTL
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen QPCTL antibody was raised using the middle region of QPCTL corresponding to a region with amino acids QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML
Assay Information QPCTL Blocking Peptide, catalog no. 33R-7631, is also available for use as a blocking control in assays to test for specificity of this QPCTL antibody

Images

Western Blot analysis using QPCTL antibody (70R-7419)

QPCTL antibody (70R-7419) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of QPCTL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance QPCTL is a single-pass membrane proteinPotential. It belongs to the glutaminyl-peptide cyclotransferase family. The exact function of QPCTL remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using QPCTL antibody (70R-7419) | QPCTL antibody (70R-7419) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors