QRSL1 antibody (70R-3579)

Rabbit polyclonal QRSL1 antibody

Synonyms Polyclonal QRSL1 antibody, Anti-QRSL1 antibody, QRSL 1 antibody, QRSL1, GatA antibody, Glutaminyl-tRNA Synthase antibody, Glutamine-Hydrolyzing-Like 1 antibody, QRSL 1, DKFZP564C1278 antibody, QRSL-1 antibody, QRSL-1, FLJ12189 antibody, FLJ13447 antibody, FLJ10989 antibody
Cross Reactivity Human
Applications WB
Immunogen QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDT
Assay Information QRSL1 Blocking Peptide, catalog no. 33R-8956, is also available for use as a blocking control in assays to test for specificity of this QRSL1 antibody


Western Blot analysis using QRSL1 antibody (70R-3579)

QRSL1 antibody (70R-3579) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of QRSL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the QRSL1 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using QRSL1 antibody (70R-3579) | QRSL1 antibody (70R-3579) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors