R3HDM2 antibody (70R-4232)

Rabbit polyclonal R3HDM2 antibody raised against the middle region of R3HDM2

Synonyms Polyclonal R3HDM2 antibody, Anti-R3HDM2 antibody, KIAA1002 antibody, R3H Domain Containing 2 antibody, RHDM2-3 antibody, RHDM2 3 antibody, R3HDM2, PR01365 antibody, RHDM2-3, RHDM2 3
Specificity R3HDM2 antibody was raised against the middle region of R3HDM2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen R3HDM2 antibody was raised using the middle region of R3HDM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG
Assay Information R3HDM2 Blocking Peptide, catalog no. 33R-7740, is also available for use as a blocking control in assays to test for specificity of this R3HDM2 antibody

Images

Western Blot analysis using R3HDM2 antibody (70R-4232)

R3HDM2 antibody (70R-4232) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of R3HDM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using R3HDM2 antibody (70R-4232) | R3HDM2 antibody (70R-4232) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors