RAB11FIP2 antibody (70R-4509)

Rabbit polyclonal RAB11FIP2 antibody

Synonyms Polyclonal RAB11FIP2 antibody, Anti-RAB11FIP2 antibody, Rab11-FIP2 antibody, RAB 11, KIAA0941 antibody, nRip11 antibody, RAB-11 antibody, RAB11, RAB 11 antibody, RAB-11, Rab11 Family Interacting Protein 2 antibody
Cross Reactivity Human
Applications WB
Immunogen RAB11FIP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
Assay Information RAB11FIP2 Blocking Peptide, catalog no. 33R-5150, is also available for use as a blocking control in assays to test for specificity of this RAB11FIP2 antibody

Images

Western Blot analysis using RAB11FIP2 antibody (70R-4509)

RAB11FIP2 antibody (70R-4509) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB11FIP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAB11FIP2 antibody (70R-4509) | RAB11FIP2 antibody (70R-4509) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors