RAB15 antibody (70R-5831)

Rabbit polyclonal RAB15 antibody raised against the N terminal of RAB15

Synonyms Polyclonal RAB15 antibody, Anti-RAB15 antibody, RAB-15, RAB-15 antibody, RAB 15, Rab15 Member Ras Onocogene Family antibody, RAB15, RAB 15 antibody
Specificity RAB15 antibody was raised against the N terminal of RAB15
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI
Assay Information RAB15 Blocking Peptide, catalog no. 33R-8810, is also available for use as a blocking control in assays to test for specificity of this RAB15 antibody


Western Blot analysis using RAB15 antibody (70R-5831)

RAB15 antibody (70R-5831) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAB15 antibody (70R-5831) | RAB15 antibody (70R-5831) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors