RAB22A antibody (70R-4379)

Rabbit polyclonal RAB22A antibody raised against the middle region of RAB22A

Synonyms Polyclonal RAB22A antibody, Anti-RAB22A antibody, RAB-22 antibody, RAB22, MGC16770 antibody, RAB 22, RAB 22 antibody, Rab22A Member Ras Oncogene Family antibody, RAB-22
Specificity RAB22A antibody was raised against the middle region of RAB22A
Cross Reactivity Human
Applications WB
Immunogen RAB22A antibody was raised using the middle region of RAB22A corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
Assay Information RAB22A Blocking Peptide, catalog no. 33R-3964, is also available for use as a blocking control in assays to test for specificity of this RAB22A antibody

Images

Western Blot analysis using RAB22A antibody (70R-4379)

RAB22A antibody (70R-4379) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB22A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAB22A antibody (70R-4379) | RAB22A antibody (70R-4379) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors