RAB38 antibody (70R-5865)

Rabbit polyclonal RAB38 antibody raised against the N terminal of RAB38

Synonyms Polyclonal RAB38 antibody, Anti-RAB38 antibody, RAB 38, NY-MEL-1 antibody, RAB-38 antibody, RAB38, rrGTPbp antibody, Rab38 Member Ras Oncogene Family antibody, RAB 38 antibody, RAB-38
Specificity RAB38 antibody was raised against the N terminal of RAB38
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAB38 antibody was raised using the N terminal of RAB38 corresponding to a region with amino acids MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV
Assay Information RAB38 Blocking Peptide, catalog no. 33R-6318, is also available for use as a blocking control in assays to test for specificity of this RAB38 antibody


Western Blot analysis using RAB38 antibody (70R-5865)

RAB38 antibody (70R-5865) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB38 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB38 may be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAB38 antibody (70R-5865) | RAB38 antibody (70R-5865) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors