RAB39B antibody (70R-5833)

Rabbit polyclonal RAB39B antibody raised against the N terminal of RAB39B

Synonyms Polyclonal RAB39B antibody, Anti-RAB39B antibody, Rab39B Member Ras Oncogene Family antibody, RABB-39 antibody, RABB 39, RABB 39 antibody, RABB-39, RAB39B
Specificity RAB39B antibody was raised against the N terminal of RAB39B
Cross Reactivity Human,Mouse
Applications WB
Immunogen RAB39B antibody was raised using the N terminal of RAB39B corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV
Assay Information RAB39B Blocking Peptide, catalog no. 33R-5891, is also available for use as a blocking control in assays to test for specificity of this RAB39B antibody

Images

Western Blot analysis using RAB39B antibody (70R-5833)

RAB39B antibody (70R-5833) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB39B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB39B may be involved in vesicular trafficking.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAB39B antibody (70R-5833) | RAB39B antibody (70R-5833) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors