RAB3IL1 antibody (70R-3158)

Rabbit polyclonal RAB3IL1 antibody

Synonyms Polyclonal RAB3IL1 antibody, Anti-RAB3IL1 antibody, RABA 3 antibody, Rab3A Interacting Protein antibody, RABA 3, Rabin3-Like 1 antibody, RAB3A, RABA-3 antibody, RABA-3, GRAB antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAB3IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH
Assay Information RAB3IL1 Blocking Peptide, catalog no. 33R-1472, is also available for use as a blocking control in assays to test for specificity of this RAB3IL1 antibody


Western Blot analysis using RAB3IL1 antibody (70R-3158)

RAB3IL1 antibody (70R-3158) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB3IL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAB3IL1 antibody (70R-3158) | RAB3IL1 antibody (70R-3158) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors